Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Stocks >

Cjc 1295 And Ghrp 6 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type


    cjc 1295 and ghrp 6 dosage

    All cjc 1295 and ghrp 6 dosage wholesalers & cjc 1295 and ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 and ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 5642 products from cjc 1295 and ghrp 6 dosage Manufactures & Suppliers
    Best CJC-1295 With DAC Dosage Safe Anti Aging Hormones Acetate Growth Hormone wholesale


    Model Number:863288-34-0

    Place of Origin:China

    .../vial CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier


    Best 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac wholesale

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier


    Best Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 wholesale

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier


    Best White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial wholesale

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier


    Best Injectable Peptides Supplements Bodybuilding CJC-1295 2mg / Vial For Performance Enhancement wholesale

    Brand Name:LSW

    Model Number:CJC-1295 2mg / Vial

    Place of Origin:China

    ..., if you visit your favorite peptide company’s internet site, you will notice that there is a CJC-1295 with, and another one without DAC. Logically, you will ask yourself - what are the differences...

    Wuhan Lianshangwang Technology Co.,Ltd
    Verified Supplier


    Best Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 wholesale

    Brand Name:HKYC

    Model Number:muscle building

    Place of Origin:HUBEI,CHINA

    ... know I will give details. Skype:live:kathelin_4 WhataApp:+8618872220706 Description 1.CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog.One...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Best CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits wholesale

    Brand Name:Yvonne

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier


    Best White Lyophilized Peptides 2mg CJC 1295 Without DAC CAS 863288-34-0 wholesale

    Brand Name:Nanjian

    Place of Origin:China

    ...White Lyophilized Peptides 2mg CJC 1295 Without DAC CAS 863288-34-0​ Quick Detail: Product Name CJC-1295 Synonym CJC-1295 Acetate; CJC1295(Without DAC) CAS NO 863288-34-0 Molecular Formula C165H271N47O46 Molecular weight 3649.30...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier


    Best CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 wholesale

    Brand Name:Muscle Man

    Model Number:863288-34-0

    Place of Origin:Hunan,China

    ...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier


    Best Injection Human Growth Peptides Cjc-1295 with Dac for Fat Burning 2mg/Vial wholesale

    Brand Name:Cjc-1295 with Dac

    Model Number:863288-34-0

    Place of Origin:China

    ... >>>>>>>>>Cjc-1295 with Dac Quick Details Cjc-1295 with Dac Other name Cjc-1295 Dac Cjc-1295 with Dac CAS 863288-34-0 Cjc-1295 with Dac Molecular Formula C165H271N47O46 Cjc-1295 with Dac Molecular Weight 3649.30 Cjc-1295 with Dac Assay 99% Min. Cjc-1295...

    HongKong Blue Universal Co., Limited.
    Verified Supplier


    Best Injecting Fat Burning Protein Polypeptide CJC 1295 With Dac CAS 863288-34-0 wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Injectable Polypeptide CJC 1295 with Dac 2mg.vial Growth Hormone Fat Burning 1. CJC-1295 With DAC Description CJC-1295 is basically a peptide hormone that acts similar to growth hormonereleasing hormones (GHRH). Invented by a Canadian ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier


    Best 99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac ( CJC-1295 without Dac ) wholesale

    Brand Name:Bodybuilding

    Model Number:CJC-1295

    Place of Origin:China

    ...99% Purity Mass-Gains Injectable Peptides Cjc 1295 No Dac (CJC-1295 without Dac) Basic Information for CJC-1295 without DAC Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier


    Best CJC-1295 with DAC Anti Aging CJC-1295 Peptide Hormones Acetate Growth Steroid wholesale

    Brand Name:steriodshow

    Model Number:863288-34-0

    Place of Origin:china manufactuer

    ...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier


    Best Human Growth Hormone Peptide Cjc-1295 Without Dac White Lyophilized Powder wholesale

    Brand Name:CJC 1295 DAC

    Model Number:N/A

    Place of Origin:China

    ...Human Growth Hormone Peptide Cjc-1295 Without Dac White Lyophilized Powder​ Product Description; Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin Molecular Formula: C165H269N47O46 Molecular weight: 3367.2 Molar Mass: 3368...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier


    Best Injectable Anabolic Steroids Peptide CJC-1295 DAC  With DAC Lyophilized Powder wholesale

    Brand Name:Kafen

    Model Number:863288-34-0

    Place of Origin:China

    ...Sell High Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC With DAC Lyophilized Powder Basic Info. other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad ...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier


    Best CJC 1295 DAC Peptide Hormones Bodybuilding CAS 863288-34-0 KOSHER Listed wholesale

    Brand Name:YUANHANG

    Model Number:863288-34-0

    Place of Origin:CHINA

    ...Good Quality CJC-1295 Fat Burning Polypeptide Hormones 2mg/vial CAS 863288-34-0 With Factory Price Abstract CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a growth hormone releasing hormone (GHRH...

    Yuanhang Bio-pharmaceutical Technology Co.,Ltd
    Verified Supplier


    Best Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles wholesale

    Brand Name:Pharmlab

    Model Number:CJC 1295

    Place of Origin:China

    ...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

    Pharmlab Co.,Ltd
    Verified Supplier


    Best Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass wholesale

    Brand Name:Latterson

    Model Number:2922199090

    Place of Origin:China

    ...Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass Basic Info Product name CJC-1295 with DAC CAS register number 863288-34-0 Molecular formula C165H271N47O46 Molecular weight 3649.30 Assay ...

    Zhongshan Latterson Biotechnology Co., Ltd.
    Active Member

    Best CAS 51753-57-2 Human Growth Peptides Cjc-1295 with Dac 2mg / Vial for Weight Loss wholesale

    Brand Name:Gear Steroids

    Model Number:51753-57-2

    Place of Origin:China

    ...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Active Member


    Best CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping wholesale

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member


    Go to Page
    Inquiry Cart 0