Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Stocks >

Cjc 1295 And Ghrp 6 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 and ghrp 6 dosage

    All cjc 1295 and ghrp 6 dosage wholesalers & cjc 1295 and ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 and ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 4344 products from cjc 1295 and ghrp 6 dosage Manufactures & Suppliers
    Best  wholesale

    Brand Name:hksteroids.net

    Model Number:863288-34-0

    Place of Origin:China

    .../vial CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Best  wholesale

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Best  wholesale

    Brand Name:HKYC

    Model Number:PEPTIDE POWDER

    Place of Origin:HUBEI,CHINA

    ...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Best  wholesale

    Brand Name:Muscle Man

    Model Number:863288-34-0

    Place of Origin:China, Hunan

    ...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Best  wholesale

    Brand Name:Cjc-1295 with Dac

    Model Number:863288-34-0

    Place of Origin:China

    ... >>>>>>>>>Cjc-1295 with Dac Quick Details Cjc-1295 with Dac Other name Cjc-1295 Dac Cjc-1295 with Dac CAS 863288-34-0 Cjc-1295 with Dac Molecular Formula C165H271N47O46 Cjc-1295 with Dac Molecular Weight 3649.30 Cjc-1295 with Dac Assay 99% Min. Cjc-1295...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Best  wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Injectable Polypeptide CJC 1295 with Dac 2mg.vial Growth Hormone Fat Burning 1. CJC-1295 With DAC Description CJC-1295 is basically a peptide hormone that acts similar to growth hormonereleasing hormones (GHRH). Invented by a Canadian ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:Anabolic-Oral Steroid

    Model Number:CJC-1295

    Place of Origin:China

    ...Injectable Peptide Steroid Human Growth CJC-1295 / CJC-1295 without DAC 2mg/vial with Colorful Tops CJC-1295 Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Best  wholesale

    Brand Name:LSW

    Model Number:CAS:863288-34-0

    Place of Origin:China

    ...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance with reasonable price and safe delivery Product Description Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Best  wholesale

    Brand Name:Gear Steroids

    Model Number:51753-57-2

    Place of Origin:China

    ...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% MOQ: 1 kit Material: Pharmaceutical Raw Material...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Best  wholesale

    Brand Name:wumeitech

    Model Number:CJC-1295 without DAC

    Place of Origin:China

    ...Peptide Hormones Bodybuilding white powder CJC-1295 without DAC Peptide Profile 2mg/vial for weight loss Storage for CJC-1295 without DAC Lyophilized MOD GRF 1-29 is stable at room temperature for 90 days...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:steriodshow

    Model Number:CJC-1295(Without DAC) CAS 863288-34-0

    Place of Origin:china manufactuer

    ...CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...White Powder Growth Hormone Peptides CJC-1295 Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:CJC 1295 DAC

    Model Number:N/A

    Place of Origin:China

    ...Human Growth Hormone Peptide Cjc-1295 Without Dac White Lyophilized Powder​ Product Description; Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin Molecular Formula: C165H269N47O46 Molecular weight: 3367.2 Molar Mass: 3368...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Best  wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367.2 Molar Mass: 3368.7 Peptide ...

    Zhuhai Shuangbojie Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:Steroidsv

    Model Number:CAS : 863288-34-0

    Place of Origin:China(Mainland)

    ...CJC-1295 DAC and CJC-1295 without DAC (2mg/vial, 10vials/kit) CAS:863288-34-0 Product Description CJC1295 DAC Product Name:...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Best  wholesale

    Brand Name:Biopro

    Model Number:GHP-39

    Place of Origin:China

    ...Purity 99% Raw Peptide Powder Lean Body Mass CJC -1295 DAC 5mg / Vial, 2mg / Vial Basic Details: Product Name: CJC1295 DAC Alias: CJC1295 with DAC ...

    Biopro Chemicals Co., Ltd.
    Verified Supplier

    Shanghai

    Best  wholesale

    Place of Origin:China

    Brand Name:YC

    Model Number:863288-34-0

    ...)-NH2 (Drug Affinity Complex) Molecular formula: C165H269N47O46 Molar Mass: 3647.15 CAS number: 863288-34-0 CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH)

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Best  wholesale

    Brand Name:N/A

    Model Number:CJC 1295

    Place of Origin:China

    ...Protuct Name CJC 1295 Appearance white power Molecular Formula C152H252N44O42 Place of Origin China (Mainland) Function bodybuilding, anti-aging ...

    Zhongweiye Biological Technology
    Site Member

    Hebei

    Best  wholesale

    Brand Name:CJC-1295 DAC

    Model Number:CAS Number 863288-34-0

    Place of Origin:China

    ...Peptide CJC-1295 DAC 2mg/vial Increases Protein Synthesis White Powder for Body Building Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Best  wholesale

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0