Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
Home > Health & Medical > Dental Equipment >

Cjc 1295 And Ghrp 6 Dosage

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 and ghrp 6 dosage

    All cjc 1295 and ghrp 6 dosage wholesalers & cjc 1295 and ghrp 6 dosage manufacturers come from members. We doesn't provide cjc 1295 and ghrp 6 dosage products or service, please contact them directly and verify their companies info carefully.

    Total 3598 products from cjc 1295 and ghrp 6 dosage Manufactures & Suppliers
    Best  wholesale

    Brand Name:ChineseHormone

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their ...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Best  wholesale

    Brand Name:Muscle Building

    Model Number:946870-92-4

    Place of Origin:China

    ...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 ...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Best  wholesale

    Brand Name:hksteroids.net

    Model Number:863288-34-0

    Place of Origin:China

    .../vial CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms ...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Best  wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuhai Shuangbojie Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:Gear Steroids

    Model Number:51753-57-2

    Place of Origin:China

    ...High Quality Peptide 51753-57-2 Cjc-1295 with Dac 2mg/Vial for Weight Loss 1, Basic Info. Model NO.: Cjc-1295 Customized: Customized Suitable for: Elderly, Adult Purity: >99% ...

    Shanghai Rong Can Science And Technology Co., Ltd.
    Verified Supplier

    Shanghai

    Best  wholesale

    Brand Name:Sendi

    Model Number:CJC-1295 With DAC

    Place of Origin:China

    ... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:CJC-1295 Without DAC

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Best  wholesale

    Brand Name:LSW

    Model Number:CAS:863288-34-0

    Place of Origin:China

    ...Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance with reasonable price and safe delivery Product Description Synonyms: CJC-1295 without DAC, CJC ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Best  wholesale

    Brand Name:Muscle Man

    Model Number:863288-34-0

    Place of Origin:China, Hunan

    ...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Best  wholesale

    Brand Name:wumeitech

    Model Number:CJC-1295 without DAC

    Place of Origin:China

    ...Peptide Hormones Bodybuilding white powder CJC-1295 without DAC Peptide Profile 2mg/vial for weight loss Storage for CJC-1295 without DAC Lyophilized MOD GRF 1-29 is stable at ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:steroidphar

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 with DAC 2 mg/ vial Growth Hormone Peptides for Muscle Gain CJC 1295 WITH DAC details: Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Injectable Polypeptide CJC 1295 with Dac 2mg.vial Growth Hormone Fat Burning 1. CJC-1295 With DAC Description CJC-1295 is basically a peptide hormone that acts similar to growth ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Best  wholesale

    Brand Name:CJC-1295 DAC

    Model Number:CAS Number 863288-34-0

    Place of Origin:China

    ...Bodybuilding Acetate 98% CJC-1295 DAC White Powder Peptide CAS 863288-34-0 Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone ...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Best  wholesale

    Categories:Growth Hormone Peptides

    Country/Region:china

    ... foil bag /box Delivery Detail: receive the payment in 1-2 days Product Description GHRP-6 Acetate Polypeptide Hormones Peptide-6 for bodybuilding GHRP-6 is an injectable ...

    Kirobiotech Co., Ltd
    ICP Remarked Supplier

    Best  wholesale

    Categories:Peptide CJC 1295

    Telephone:+8618578209853

    Country/Region:china

    ... Buy CJC-1295 Without DACAlias: CJC-1295 Acetate; CJC-1295(Without DAC) ;Sequence: Tyr-D-Ala-Asp-Ala Previous:CJC-1295 DAC 2mg uk results buy Next:GHRP-2 Peptide Cycle Results ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    ICP Remarked Supplier

    Best  wholesale

    Categories:Growth Hormone Peptides

    Country/Region:china

    ...Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 ...

    Zhuhaishi Shuangbojie Technology Co., Ltd,
    ICP Remarked Supplier

    Best  wholesale

    Categories:Human Growth Hormone Peptide

    Country/Region:china

    ... For Customs Pass Guaranteed Usage: Pharmaceutical Material CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: ...

    Zhuzhou Interial Biotechnology Co., Ltd
    ICP Remarked Supplier

    Best  wholesale

    Place of Origin:jiangsu

    Brand Name:hugerawsales06@hotmail.com

    Model Number:skype:live:hugerawsales06

    ...Detailed Product Description Ipam Ipamorelin Peptide CJC-1295 DAC Sermorelin USP Peptides For Bodybuilding Quick detail Ipamorelin Alias: Ipamorelin Acetate,Ipamorelin,IPAM, NNC...

    Hugeraw Health Technology Co.,Ltd
    Active Member

    Jiangsu

    Best  wholesale

    Categories:Human Growth Hormone Peptide

    Telephone:+86-755-66601416

    Country/Region:china

    ...99% CJC-1295 with DAC powder E-mail:claire@chembj.com Skype: live:695059711 whats app: +8615527046746 Quick detail What is CJC-1295 With DAC ? CJC-1295 with DAC is a peptide ...

    Shenzhen Sendi Biotechnology Co.,Ltd
    ICP Remarked Supplier

    Best  wholesale

    Brand Name:SHUCHAN

    Model Number:863288-34-0

    Place of Origin:wuhan

    keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha...

    ShangHai ShuCan Industrial Co,.LTD
    Active Member

    Shanghai

    Go to Page
    Inquiry Cart 0