Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Organic Salt >

Cjc 1295 With Dac 2mg

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 with dac 2mg

    All cjc 1295 with dac 2mg wholesalers & cjc 1295 with dac 2mg manufacturers come from members. We doesn't provide cjc 1295 with dac 2mg products or service, please contact them directly and verify their companies info carefully.

    Total 6504 products from cjc 1295 with dac 2mg Manufactures & Suppliers
    Quality Muscle Enhance Growth Hormone Peptides CJC 1295 Without Dac 2mg / Vial wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 Molecular ...

    Zhuhai Shuangbojie Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Quality CAS 863288-34-0 Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding wholesale

    Brand Name:BestSteroid

    Model Number:863288-34-0

    Place of Origin:Hubei,China

    Growth Hormone Peptides CJC-1295 Without DAC 2mg For Bodybuilding CJC-1295 Basic Info Sequence H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Quality CJC - 1295 With Dac , 2mg / Vial Peptide Hormones Bodybuilding Fat Burning weight on 863288-34-0 wholesale

    Brand Name:Pharmagrade Steroids

    Model Number:863288-34-0

    Place of Origin:China

    CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Quality Powerful Growth Hormone Peptides CJC-1295 with DAC 2mg /Vial for Bodybuilding wholesale

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    Powerful Growth Hormone Peptides CJC-1295 with DAC for Bodybuilding 2mg /Vial Quick detail Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Quality CJC-1295 Without DAC 2mg Lyophilized Peptide High Purity CJC-1295 No DAC wholesale

    Brand Name:steriodshow

    Model Number:CJC-1295 Without DAC (2mg/vial)

    Place of Origin:china manufactuer

    CJC-1295 Without DAC 2mg Lyophilized Peptide High Purity CJC-1295 No DAC Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price served; ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Quality 99% Purity White Powder Peptides Hormones Cjc-1295 With Dac (2mg/vial) Fat Loss Human Growth wholesale

    Brand Name:Muscle

    Model Number:CAS 863288-34-0

    Place of Origin:Hunan,China

    Quick Detail: Product Name CJC-1295 With DAC / CJC-1295 DAC Synonyms CJC1295(GHRH/DAC), CJC1295 DAC(Drug Affinity Complex), CJC-1295 with dac, CJC 1295 CAS 863288-34-0 MF ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Quality Fat Burner Peptide Human Growth Peptides Cjc 1295 Without Dac 2mg / Vial CAS 863288-34-0 wholesale

    Brand Name:ChineseHormone

    Model Number:863288-34-0

    Place of Origin:China

    Fat Burner Peptide Human Growth Cjc 1295 Without Dac 2mg/Vial CAS 863288-34-0 CJC-1295 DAC vs. CJC-1295 No DAC: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both ...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Quality Muscle Enhance Growth Hormone Peptides CJC 1295 Without Dac 2mg / Vial wholesale

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    Growth Hormone Peptides Steroid Cjc - 1295 Without Dac 2mg / vial for Muscle Enhance Quick Details: CJC-1295 without DAC CAS 863288-34-0 Molecular Formula: C152H252N44O42 Molecular ...

    Zhuhai Shuangbojie Technology Co.,Ltd
    Verified Supplier

    Guangdong

    Quality Human Growth Peptides CJC 1295 Without DAC 2mg / vial For Bodybuilder wholesale

    Brand Name:Huao

    Model Number:CAS : 863288-34-0

    Place of Origin:China

    Human Growth Peptides CJC 1295 Without DAC 2mg / vial For Bodybuilder Quick detail : CJC-1295 without DAC Product name : CJC-1295 without dac Synonyms : CJC-1295 without DAC, CJC ...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Quality Anti Aging Peptide Injections CJC1295 / CJC-1295 Without DAC 2mg/Vial wholesale

    Brand Name:anabolic-oral steroids

    Model Number:CJC1295

    Place of Origin:China

    Colorful Tops Peptides CJC1295 / CJC-1295 without DAC 2mg/vial for Increase GH CJC-1295 DAC vs. CJC-1295 No DAC: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Quality Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning wholesale

    Brand Name:rina@pharmade.com

    Model Number:skype: zarazhou3

    Place of Origin:China

    Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning Buy CJC-1295 with DAC Online from rina at pharmade dot com Density:1.45 CJC-1295 with DAC Product Description: ...

    Shenzhen Shijingu Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Quality White Injectable GHRH Human Growth Hormone Powder CJC-1295 With DAC 2mg/Vial wholesale

    Brand Name:CJC-1295 With DAC

    Model Number:51753-57-2

    Place of Origin:China

    White Injectable GHRH Human Growth Hormone Powder CJC-1295 With DAC 2mg/Vial Quick Detail: Product Name CJC-1295 DAC Specification 2mg/vial Category Peptide Shipping Methods EMS, ...

    Shenzhen RuiJin Pharmaceutical Co.,Ltd
    Verified Supplier

    Guangdong

    Quality Legal Safe Peptide Hormones Bodybuilding CJC-1295 without DAC 2mg / vial for Muscle Mass wholesale

    Brand Name:wumeitech

    Model Number:10vials

    Place of Origin:China

    Legal Safe Peptide Hormones Bodybuilding CJC-1295 without DAC 2mg / vial for Muscle Mass 1. CJC-1295 without DAC basic: Name: CJC-1295 without DAC Synonyms: FST, FS, Activin...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Quality HPLC 99% Purity Lab Peptides Cjc-1295 Without Dac , 2mg / vial 10 vials / kit wholesale

    Brand Name:HBU

    Model Number:87616-84-0

    Place of Origin:CHINA

    99% Purity Lab Peptides Cjc-1295 (2mg/vial, 10vials/kit) Peptides Cjc-1295 Without Dac CJC-1295 Without Dac CAS:87616-84-0 MF:C152H252N44O42 MW:3367.2 Purity (HPLC):98% Appearance: ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Quality Fat Burner Peptide Human Growth Cjc 1295 Without Dac 2mg/Vial CAS 863288-34-0 wholesale

    Brand Name:Shucan

    Model Number:863288-34-0

    Place of Origin:China

    Quick Detail: CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys...

    Shanghai Shucan Industrial Co.,Ltd
    Verified Supplier

    Shanghai

    Quality CJC-1295 without DAC 2mg/vial wholesale

    Place of Origin:China

    Brand Name:saichuang

    Model Number:51753-57-2

    CJC-1295 without DAC 2mg/vial CJC-1295 without Dac (2mg/Vial / 10vial/Kit) Item: CJC1295 CAS Registry Number: 51753-57-2 Names: CJC 1295MF: C152H252N44O42 Type: Immune Function ...

    Wuhan Yuancheng Gongchuang Technology Co.,Ltd
    Site Member

    Hubei

    Quality CJC 1295,without DAC CJC 1295,without DAC 2mg/vial wholesale

    Categories:health products

    Telephone:86-27-87158518

    Country/Region:china

    We offer Peptides finished products and powder,if you have interesting in it,please contact me. Please Send your email address into your inquiry,thank you! GHRP-6 5mg/vial GHRP-2 ...

    HUMANS TECHNOLOGY CO LTD
    Site Member

    Hubei

    Quality 99% Factory Supply Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning wholesale

    Brand Name:YC

    Model Number:Email:sophia525@yccreate.com

    Place of Origin:China factory direct

    Qick Detail Factory Supply Medicine Grade Polypeptide CJC-1295 with DAC 2mg/vial For Fat Burning (sophia525 at yccreate dot com) (Skype:sophia525600) (Facebook:sophia525 at ycgmp ...

    Wuhan Pharmaceutical Co., Ltd.
    Site Member

    Guangdong

    Quality CJC-1295 with DAC 2mg/vial Weight Loss Steroids Cjc-1295 DAC Polypeptide Manufacturer wholesale

    Brand Name:Simeiquan

    Model Number:2mg/vial

    Place of Origin:China

    CJC-1295 with DAC 2mg/vial Weight Loss Steroids Cjc-1295 DAC Polypeptide Manufacturer CJC1295 DAC Product Name:CJC1295 DAC;CJC1295 with DAC Alias: CJC1295(GHRH/DAC) Sequence: Tyr-D...

    Shenzhen Simeiquan Biotechnology Co., Ltd.
    Active Member

    Guangdong

    Quality Medical Grad Human Growth Peptide Hormone CJC-1295 Without Dac 2mg/Vial wholesale

    Brand Name:HKSJG

    Model Number:BULKRAWS

    Place of Origin:China

    Product Description Peptide Hormone Cjc-1295 Without Dac 2mg/Vial Factory Price CJC-1295 without DAC 2mg/vial 1.product descroption: Product name: Cjc-1295 Without Dac Cjc-1295 ...

    HongKong Shijingu Technology Co.,Ltd
    Active Member

    Hongkong

    Quality GHRH CJC 1295 with DAC 2mg / Vial , Peptides CJC 1295 DAC for Injection wholesale

    Brand Name:CJC-1295 DAC

    Model Number:CAS Number 863288-34-0

    Place of Origin:China

    GHRH CJC 1295 with DAC 2mg/Vial, Peptides CJC 1295 DAC for Injection with Safe Shipment Detailed Product Description Brand Name CJC 1295 DAC Molecular Formula C165H269N47O46 ...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Go to Page
    Inquiry Cart 0