Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    raw steroid powder uk

    All raw steroid powder uk wholesalers & raw steroid powder uk manufacturers come from members. We doesn't provide raw steroid powder uk products or service, please contact them directly and verify their companies info carefully.

    Total 9958 products from raw steroid powder uk Manufactures & Suppliers
    Best Raw Steroid Powders yk11 99.9% return policy fast and safe best service good quality wholesale

    Brand Name:YK11

    Model Number:ISO9001

    Place of Origin:China

    ...Raw Steroid Powders yk11 99.9% return policy fast and safe best service good quality Email:tinaprochem@gmail.com ...

    Shandong Chuangrui Chemical Technology Co., Ltd.
    Verified Supplier

    Shandong

    Best 99% Testosterone Acetate CAS 1045-69-8 raw steroid powder for weight loss and bodybuilding wholesale

    Brand Name:yuancheng

    Model Number:58-22-0

    Place of Origin:China

    ...Quick Detail Basic Info. Alias:Aceto-Sterandryl Appearance:White Crystalline Powder Purity:99% CAS:1045-69-8 EINECS:213-876-6 MF:C21H30O3 MW:330.46 Melting Point:...

    RAWSGEAR MANUFACTURER
    Verified Supplier

    Hubei

    Best Buy 4F-ADB Pure Research Chemicals Anabolic Steroid Powder ISO SGS Listed 4f raws powder pharmaceutical intermediates wholesale

    Brand Name:Global

    Model Number:4fadb

    Place of Origin:China

    ... Skype:live:.cid.94b1cc41e52eb06a Watsapp:+8615069920418 Description: Product Name 4FADB Other Name 4F,4f Appearance Powder Application For the Lab Purity 99.8%/99.7% Price Negotiable MOQ 1g Storage Keep in cool...

    Global chemicals Co.,Ltd
    Verified Supplier

    Best Bupivacaine Hydrochloride Local Anesthetic Powder Adrenaline HCl 99% Pure For Sale wholesale

    Brand Name:TY-Chemical

    Model Number:14252-80-3

    Place of Origin:China(WhatsApp:+8618148706580)

    .... $ We are top steroid & Local anesthetic manufacturer of China. More than 200 kg of steroid powder is supplied to the European high-end market every month. Germany,Brazil ,USA, Spain, UK, France, Canada, Mexico...

    Guangzhou Teng yue Chemical Co., Ltd.
    Verified Supplier

    Guangdong

    Best Estrone Raw Steroid Powder Bodybuilding Supplements Steroids Highly Pure Material wholesale

    Brand Name:Estrone

    ...Estrone Raw Steroid Powder Pharmaceutical Intermediates Purity 99.5% Whatsapp:+8613165394499 Email:jerryrcchem@gmail.com Skype:jameearon@outlook.com Quick ...

    Hubei KUKE Chemcial Co., Ltd
    Verified Supplier

    Hubei

    Best Desloratadine Raw Steroid Powder For Relief Allergic Rhinitis Pharmacy ,  No 100643-71-8 wholesale

    Brand Name:Hongkong Saichuang

    Model Number:Raw steroid powder

    Place of Origin:China

    ...Desloratadine Raw Steroid Powder For Relief Allergic Rhinitis Pharmacy , No 100643-71-8 Desloratadine English Synonyms: DESLORATADINE;DESLORATIDINE;8-chloro-6,11-...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Best Methenolone Enanthate Raw Steroid Powder For Muscle Gain and Growth Hormone Bodybuilding wholesale

    Brand Name:HAIWEN

    Model Number:303-42-4

    Place of Origin:shenzhen,China

    ...Methenolone Enanthate Raw Steroid Powder For Muscle Gain and growth hormone bodybuilding Quick Detail: Methenolone Enanthate Alias: Primobolan-depot; meth ...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Best lgd4033 Raw steroid powder with high purity wholesale price online sarms products wholesale

    Brand Name:lgd4033

    Place of Origin:China

    ...lgd4033 Raw steroid powder with high purity wholesale price online sarms products Email:tinaprochem@gmail.com Skype: live:tinaprochem ...

    Shandong Shengri Chemical Co., Ltd.
    Verified Supplier

    Shandong

    Best Pharmaceutical Raw Steroid Powders , Testosterone Decanoate Steroid Raws wholesale

    Brand Name:SR

    Model Number:ISO9001

    Place of Origin:China

    ...steroid raws Testosterone Decanoate Powder steroid raws Pharmaceutical raw materials, Steroid hormone, Anabolin 1. Why choose us 1. Rich experience We specialize in this filed for many years,...

    RCchemshop
    Verified Supplier

    Shandong

    Best Pharmaceutical Intermediate Methenolone Enanthate / Primobolan Depot Raw Steroid Powder CAS 303-42-4 wholesale

    Brand Name:YIHAN

    Model Number:303-42-4

    Place of Origin:CHINA

    ...Pharmaceutical Intermediate Methenolone Enanthate / Primobolan Depot Raw Steroid Powder CAS 303-42-4 Quick detail: Product name: Methenolone enanthate Synonyms: Primobolan Depot; Primo; PRIMOBOLAN-DEPOT; ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Best Natural Sustanon 250 / Testosterone Blend Raw Steroid Powders for Muscle Building wholesale

    Place of Origin:China

    Brand Name:Taigui

    ...Natural Sustanon 250 / Testosterone Blend Raw Steroids Powders for Muscle Building Quick Detail: Product name Sustanon 250 Factory Supplying Other name Testosterone Blend; ...

    Shanghai Taigui Pharmaceutical Technology Co., Ltd
    Verified Supplier

    Shanghai

    Best Off - White Crystalline Raw Steroid Powders / Muscle Growth Hormone For Bodybuilding from USA Shipping wholesale

    Brand Name:KA-XING

    Model Number:315-37-7

    Place of Origin:Guangdong ,China

    ...-Leu-Ser-Arg-NH2 Molecular formula: C152H252N44O42 Molecular weight: 3367.97 Purity: 98% Traits: white powder CJC-1295 without DAC, a 29-amino acid peptide with sequence Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2, is a tetrasubstituted peptide...

    Zhuhai Jiacheng Bio-Tech Co., Ltd.
    Verified Supplier

    Macau

    Best White Estradiol Raw Steroid Powders Infrared Absorption High Pure wholesale

    Brand Name:Holybiological

    Model Number:50-28-2

    Place of Origin:China

    ...White Estradiol Raw Steroid Powders Infrared Absorption High Pure Product Details: 1, Manufacturer :Holy Biological 2, MF:C18H24O2 3, MW:272.38 4, Purity:99% 5, Character: White Crystalline Powder 6, Stability: Stable. Incompatible with strong oxidizing ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Best White Estradiol Raw Steroid Powders Infrared Absorption High Pure wholesale

    Brand Name:Holybiological

    Model Number:50-28-2

    Place of Origin:China

    ...White Estradiol Raw Steroid Powders Infrared Absorption High Pure Product Details: 1, Manufacturer :Holy Biological 2, MF:C18H24O2 3, MW:272.38 4, Purity:99% 5, Character: White Crystalline Powder 6, Stability: Stable. Incompatible with strong oxidizing ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Best Anti Estrogen Raw Steroid Powders Clomid Clomifene Citrate For Anti Cancer wholesale

    Brand Name:Steroids

    Model Number:USP

    Place of Origin:China

    ...Anti-Estrogen Steroid Powder Clomid Clomifene Citrate For Anti Cancer CAS NO.50-41-9 Superiority 1. rich experience. having been ...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Best Healthy Raw Steroid Powders Female Hormone Progesterone Powder CAS 57-83-0 wholesale

    Brand Name:shinrezing

    Model Number:57-83-0

    Place of Origin:china

    ...Progesterone Breast Cancer Treatment Female Sex Hormone Steroid Powder CAS 57-83-0 Product description: Progesterone is a steroid hormone secreted by the corpus luteum of the ovary and contains 21 carbon atoms. There ...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Best Fast Muscle Raw Steroid Powder Oral Nandrolone Base For Joint Pain wholesale

    Brand Name:WHYC

    Model Number:Nandrolone Base CAS 434-22-0

    Place of Origin:Wuhan,Hubei,China

    ...Muscle Building Raw Steroid Powder Nandrolone Base CAS 434-22-0 Description: Nandrolone Base is an anabolic steroid which is most commonly sold commercially as its decanoate ester (Deca-Durabolin) and less commonly ...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Best Tetracaine Hydrochloride Raw Steroid Powders White Powder Form CAS 120-51-4 wholesale

    Brand Name:GZ Body Chemical

    Model Number:CAS 136-47-0

    Place of Origin:China

    ...Tetracaine hydrochloride Raw Steroid Powders Tetracaine HCL Safe Clearance EU,USA,UK,France Quick details: Chemical name:Benzyl Benzoate Alias: benzoic acid benzyl ester; benzyl benzoate; BB ...

    GZ Body Chemical Co., Limited
    Verified Supplier

    Guangdong

    Best 99% Testosterone Decanoate Raw Steroid Powder CAS: 5721-91-5  white crystalline powder male sex hormone wholesale

    Model Number:5721-91-5

    Place of Origin:China

    ...99% Testosterone Decanoate Raw Steroid Powder CAS: 5721-91-5 Description: Testosterone Decanoate (Steroids) Synonyms: testosterone caproate;4-Androsten-17beta-ol-3-one Decanoate CAS: 5721-91-5 EINECS: 227-226-4 Mocular ...

    HUBEI AOKS TRADE CO.,LTD
    Active Member

    Hubei

    Best Natural Anti Estrogen Steroids Clomiphene Citrate Clomid Powder CAS 50-41-9 apa fungsi obat provula clomifene citrate wholesale

    Brand Name:Aoks

    Model Number:50-41-9

    Place of Origin:China

    ...Natural Anti Estrogen Steroids Clomifene Citrate Clomid Antistrogen Powder CAS 50-41-9 apa fungsi obat provula clomifene citrate Description: Clomid is a mixed estrogen agonist/...

    Wuhan Monad Medicine Tech Co.,LTD
    Active Member

    Hubei

    Go to Page
    Inquiry Cart 0