Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Organic Intermediate >

Sermorelin Ghrp 2 Side Effects

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    sermorelin ghrp 2 side effects

    All sermorelin ghrp 2 side effects wholesalers & sermorelin ghrp 2 side effects manufacturers come from members. We doesn't provide sermorelin ghrp 2 side effects products or service, please contact them directly and verify their companies info carefully.

    Total 11511 products from sermorelin ghrp 2 side effects Manufactures & Suppliers
    Quality 99.9% Purity GHRP6 Human Growth Hormmone Polypeptide GHRP -6 5mg / vial wholesale

    Brand Name:YC

    Model Number:GHRP-6

    Place of Origin:China

    99.9% Purity GHRP6 Human Growth Hormmone Polypeptide GHRP -6 5mg / vial Description of Ghrp6: Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: ...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Quality Research Chemical 99.9% Human Growth Peptide Powder 10mg/vial Ghrp-6 For Weight Loss wholesale

    Brand Name:Muscle Man

    Model Number:87616-84-0

    Place of Origin:China, Hunan

    Research Chemical 99.9% Human Growth Peptide Powder 10mg/vial Ghrp-6 For Weight Loss Quick detail: Ghrp-6 Product Name: GHRP-6 Ghrp-6 Chemical Name: Growth hormon releasing peptide...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Quality Body Building Sermorelin Peptide Steroid Hormones White Powder 86168-78-7 wholesale

    Brand Name:JNJG

    Model Number:86168-78-7

    Place of Origin:CHINA

    White Powder Peptides 2mg/Vial Sermorelin Acetate For Bodybuilding 86168-78-7 Sermorelin Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias ...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Quality Ghrp-6 Bodybuilding Prohormones for Muscle man 10mg/Vial 98% High Purity wholesale

    Brand Name:Yuancheng

    Place of Origin:China

    Model Number:steroidchina.com

    GHRP-6 (Growth hormone releasing peptide) Ghrp-6 Growth hormone releasing peptide CAS 87616-84-0 Factory Direct English Title: Growth hormone releasing peptide Alias: GROWTH ...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Quality Injectable hgh Growth Hormone Peptides steroids powder Sermorelin acetate cycle GHRH wholesale

    Brand Name:SENDI

    Model Number:YC001

    Place of Origin:CHINA

    Hello,This is Cherry from China.we offer Sermorelin 2mg/vial,CAS 86168-78-7 besides, we have offer GHRP peptide like GHRP-2;GHRP-6;ipamorelin;PEG-MGF;MGF if you are interested,plz ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Quality Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial wholesale

    Brand Name:Shuangbojie

    Model Number:Sermorelin Acetate

    Place of Origin:China

    Safest Lyophilized Peptide Growth Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Quality Injectable Peptides Steroids Sermorelin 2mg / Vial For Muscle Building 86168-78-7 wholesale

    Brand Name:JCJ

    Model Number:CAS: 86168-78-7

    Place of Origin:China

    Injectable Polypeptide Hormones Sermorelin 2mg / Vial for Muscle building Weight Loss Detail Sermorelin - synthetic version of the peptide hormone GHRH Cas No.: 86168-78-7 Purity ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Quality Natural Growth Peptides GHRP-6 Cycle 5mg 10mg For Muscle Gain Peptides wholesale

    Brand Name:Guangzhou Huao

    Model Number:158861-67-7

    Place of Origin:Guangzhou China

    Human Growth Peptides GHRP-6 Cycle 5mg 10mg For Muscle Gain Peptides Basic Information for GHRP-6 GHRP-6--CAS NO.: 87616-84-0 GHRP-6--Other title: GHRP-6 GHRP-6--MW: 873.01 GHRP-6-...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Quality Sermorelin bodybuilding benefits Sermorelin Acetate ghrp-6 uses reviews buy online wholesale

    Brand Name:steriodshow

    Model Number:Sermorelin Acetate CAS 86168-78-7

    Place of Origin:china manufactuer

    Sermorelin Acetate Cas No.: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Quality Sermorelin Acetate Peptide Hormones Bodybuilding Freeze-Dried Powder GRF (1-29) wholesale

    Brand Name:wumeitech

    Model Number:Sermorelin vials or Sermorelin Acetate Powder Form

    Place of Origin:China

    Sermorelin Acetate Peptide Hormones Bodybuilding Freeze-Dried Powder GRF (1-29) Product Name Sermorelin Acetate Also known as Sermorelin Appearance Freeze-Dried White Powder ...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Quality GHRP- 6 99% Purity Growth Hormone Peptides for Losing Weight , CAS 87616-84-0 wholesale

    Brand Name:Biopro

    Model Number:GHP-27

    Place of Origin:China

    GHRP- 6 99% Purity Growth Hormone Peptides for Losing Weight , CAS 87616-84-0 GHRP-6 has recently been of considerable interest in the nutritional community for its unique ...

    Biopro Chemicals Co., Ltd.
    Verified Supplier

    Shanghai

    Quality Diagnostic Agent Sermorelin 2mg Peptides Hormones CAS 86168-78-7 wholesale

    Brand Name:Shuangbojie

    Model Number:nutrition@chembj.com

    Place of Origin:China

    Polypeptide Hormone Sermorelin 2mg CAS 86168-78-7 for Diagnostic Agent Usage Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Quality Growth Hormone Releasing Peptide GHRP-2 5mg 10mg For Anti-Aging And Lean Body wholesale

    Brand Name:Pharmlab

    Model Number:158861-67-7

    Place of Origin:China

    Growth Hormone Releasing Peptide GHRP-2 5mg 10mg For Anti-Aging And Lean Body 1. Quick detail Product name : GHRP-2 CAS : 158861-67-7 MF: C42H50N8O5 MW: 746.91 Specification: 5mg...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Quality Pharmaceutical Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging wholesale

    Brand Name:BestSteroid

    Model Number:158861-67-7

    Place of Origin:Hubei,China

    Growth Hormone Peptides GHRP-2 5MG Releasing Peptide For Muscle Gain and Anti Aging GHRP-2 Basic Info GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate CAS: 158861-67-7 M.F.: C42H50N8O5 M...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Quality GHRP-6 Peptide Hormones Bodybuilding CAS 87616-84-0 , White Crystal powder wholesale

    Brand Name:LSW

    Model Number:87616-84-0

    Place of Origin:China

    Top Quality GHRP-6 Bodybuilding Peptides CAS 87616-84-0 for Reducing Levels of Body Fat Quick Details: Product name:GHRP-6 Other name:GHRP-6 Acetate;His(1)-lys(6)-ghrp;GH-Releasing ...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hong Kong

    Quality Sermorelin , GHRH , Muscle Growth Polypeptide Hormone CA 86168-78-7 wholesale

    Brand Name:yc

    Model Number:Sermorelin Acetate

    Place of Origin:China

    Sermorelin, GHRH, Muscle Growth Polypeptide Hormone, CAS: 86168-78-7 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Quality Hot Injectable Human (Growth) Peptide Hormone Ghrp-6 for Muscle Gaining wholesale

    Brand Name:HKYC

    Model Number:Human (Growth) Peptide Hormone

    Place of Origin:China

    Hot Injectable Human (Growth) Peptide Hormone Ghrp-6 for Muscle Gaining Basic Info: Port: Hong Kong, Hong Kong Production Capacity:500kg/Month Payment Terms:T/T, Western Union, ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Quality CAS 158861-67-7 Testosterone Peptide Hormone Polypeptide Ghrp-2 / Pralmorelin wholesale

    Brand Name:NJBN STERIOD

    Model Number:158861-67-7

    Place of Origin:Made-in-China

    CAS 158861-67-7 Testosterone Peptide Hormone Polypeptide Ghrp-2 / Pralmorelin Quick Details Product Name Pralmorelin / GHRP-2 Alias KP 102, GHRP2, GHRP 2 Synonyms PRALMORELIN;D-ALA...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Quality Fat loss 5Mg/10Mg GHRP-6  Growth Hormone Releasing Peptide-6 For Recomping Or Cutting. wholesale

    Brand Name:SMQ

    Model Number:growth hormone peptides

    Place of Origin:china

    Fat loss 5Mg/10Mg GHRP-6 Growth Hormone Releasing Peptide-6 For Cutting. Quick detail Product Name GHRP-6 Chemical Name Growth hormone releasing peptide-6 CAS Number 87616-84-0 ...

    Shenzhen Simeiquan Biotechnology Co., Ltd.
    Verified Supplier

    Guangdong

    Quality Peptide GHRP 6 Bodybuilding Human Growth Hormone Powder Water Based Injectable wholesale

    Brand Name:Ycphar

    Model Number:87616-84-0

    Place of Origin:China

    Peptide GHRP 6 Bodybuilding Human Growth Hormone Powder Water Based Injectable Quick Detail of GHRP-6 Product Name;GHRP-6 Chemical Name;Growth hormon releasing peptide-6 CAS Number...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Go to Page
    Inquiry Cart 0