sermorelin growth hormone

Brand Name:Ycphar

Model Number:863288-34-0

Place of Origin:China

CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 CAS Number 863288-34-0 Purity >98% by HPLC Molecular Formula C152H8252N44O42 Apperance white powder General Infomation Of CJC 1295 Description CJC-1295 DAC and CJC-1295 (also known as

Brand Name:Fulu

Model Number:86168-78-7

Place of Origin:China

Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification 2mg/vail Assay 99.5% Appearance White powder Sermorelin Descriptions Sermorelin ( GHRH ) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Hormone Releasing Hormone ( GHRH ) from the hypothalamus, a

Brand Name:Shuangbojie

Model Number:Sermorelin Acetate

Place of Origin:China

Polypeptide Growth Hormone Sermorelin Acetate/ Sermorelin with 2mg Bodybuilding 1. Sermorelin Information: Product Name:Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 Molecular weight: 3357.88 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: H-Tyr-Ala-

Model Number:99%

Place of Origin:China

Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular Formula C149H246N44O42S One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month

Brand Name:Fulu

Model Number:86168-78-7

Place of Origin:China

...Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification ...

Brand Name:Ycphar

Model Number:86168-78-7

Place of Origin:China

...Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

Brand Name:BestSteroid

Model Number:2mg

Place of Origin:Hubei,China

...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-...

Brand Name:Sendi

Model Number:GDF-8

Place of Origin:China

...Freeze - Dried Powder Gdf -8 / Myostatin Human Growth Hormone Peptides GDF - 8 MOQ: 10 vials Payment: Bank Transfer, Western Union, MoneyGram, Bitcoin Shipping Method: HKEMS, ...

Brand Name:Pharmlab

Model Number:218949-48-5

Place of Origin:China

...Bodybuilding Hormone Peptide Anabolic Steroids Weight Loss Tesamorelin 2mg/ Vial Quick detail Product name: Tesamorelin Other name: Sermorelin Acetate CAS: 218949-48-5 Appearance: white lyophilized powder purity: 99% Trademark: Pharmlab Original: China...

Brand Name:steriodshow

Model Number:Hexarelin 2mg / vial

Place of Origin:china manufactuer

...Hexarelin 2mg Lyophilized Peptide High Purity Hexarelin Acetate HEX Releasing Peptide Growth Hormone Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price served; ...

Brand Name:DW

Model Number:CAS No:50-56-6

Place of Origin:China

...Medicine Grade Oxytocin Growth Hormone Peptides / HGH Peptide Fragment CAS 50-56-6​ 1 . Specification Product Name: Oxtocin CAS: 50-56-6 ...

Brand Name:Yvonne

Model Number:50-56-6

Place of Origin:China

...Growth Hormone Peptides Oxytocin 2mg / vial For Hasten Parturition CAS 50-56-6 1. Oxytocin Details: Name: oxytocin synonyms: +...

Brand Name:Mking

Model Number:CAS 53-39-4

Place of Origin:Hubei, China

...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...

Brand Name:YIHAN

Model Number:IGF-1 LR3

Place of Origin:CHINA

...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS ...

Brand Name:Gensci

Model Number:10iu/vial,10vials/kit

Place of Origin:China manufacturer

...Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth == What kind of HGH do you have ? Here is our HGH in the from,pls ...

Model Number:99%

Place of Origin:China

...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

Brand Name:NJBN STEROID

Model Number:140703-51-1

Place of Origin:MADE IN CHINA

... Growth Hormone Peptides Hexarelin CAS 140703-51-1 Brief Inreocution of Growth Hormone Peptides Hexarelin Product name Hexarelin Other Name HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE...

Brand Name:YC

Model Number:158861-67-7

Place of Origin:China

...Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7​ GHRP-2, like its brother GHRP-6, is a hexapeptide that is a pure growth hormone secretagogue. In addition, GHRP-2 is a synthetic...

Brand Name:Bodybiological

Model Number:96827-07-5

Place of Origin:Hubei, China

...Hygetropin Human Growth Hormone Peptide HGH 191AA 100iu Hygetropin GH Product details: CAS No. : 96827-07-5 Purity : 97% Place ...

Brand Name:Yuancheng

Model Number:57773-63-4

Place of Origin:China

...Fitness Growth Hormone Peptides Gh Fragment 176-191 H-GH Fragments 176-191 Details H-GH Fragments 176-191 Name: ...

Brand Name:Blue Dragon

Model Number:GHRP-6 5mg & 10mg

Place of Origin:China Manufacturer

...99% GHRP-6 5mg Growth Hormone Releasing Hexapeptide 10mg 87616-84-0 Fat Loss 1, GHRP-6 Profile: Product Name: GHRP-6 Specification: 5mg & 10mg Synonyms: Growth Hormone Release Peptide-6; Growth Hormone Releasing Hexapeptide CAS: 87616-84-0 MF: C46H56N12O6 ...

Brand Name:Biofriend

Model Number:140703-51-1

Place of Origin:China

...Hexarelin Powder Performance Enhancing Human Growth Hormone Peptide For Fat Loss CAS 140703-51-1 Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-...

Brand Name:Biopro

Model Number:PEP-116

Place of Origin:China

... Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding Description Sermorelin Acetate, also known as GRF 1-29 Amide, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth...

Brand Name:HZ

Model Number:86168-78-7

Place of Origin:China

...Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 ...