Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Projects >

Sermorelin Growth Hormone

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    sermorelin growth hormone

    All sermorelin growth hormone wholesalers & sermorelin growth hormone manufacturers come from members. We doesn't provide sermorelin growth hormone products or service, please contact them directly and verify their companies info carefully.

    Total 7718 products from sermorelin growth hormone Manufactures & Suppliers
    Best CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC wholesale

    Brand Name:Ycphar

    Model Number:863288-34-0

    Place of Origin:China

    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 CAS Number 863288-34-0 Purity >98% by HPLC Molecular Formula C152H8252N44O42 Apperance white powder General Infomation Of CJC 1295 Description CJC-1295 DAC and CJC-1295 (also known as

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Best Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical wholesale

    Brand Name:Fulu

    Model Number:86168-78-7

    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification 2mg/vail Assay 99.5% Appearance White powder Sermorelin Descriptions Sermorelin ( GHRH ) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Hormone Releasing Hormone ( GHRH ) from the hypothalamus, a

    SuZhou FuLu Biotech Co.,Ltd
    Verified Supplier

    Jiangsu

    Best Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients  wholesale

    Brand Name:Shuangbojie

    Model Number:Sermorelin Acetate

    Place of Origin:China

    Polypeptide Growth Hormone Sermorelin Acetate/ Sermorelin with 2mg Bodybuilding 1. Sermorelin Information: Product Name:Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 Molecular weight: 3357.88 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: H-Tyr-Ala-

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Best Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 wholesale

    Model Number:99%

    Place of Origin:China

    Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular Formula C149H246N44O42S One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Best Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical wholesale

    Brand Name:Fulu

    Model Number:86168-78-7

    Place of Origin:China

    ...Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification ...

    SuZhou FuLu Biotech Co.,Ltd
    Verified Supplier

    Jiangsu

    Best Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 wholesale

    Brand Name:Ycphar

    Model Number:86168-78-7

    Place of Origin:China

    ...Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Best Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding wholesale

    Brand Name:Biopro

    Model Number:PEP-116

    Place of Origin:China

    ... Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding Description Sermorelin Acetate, also known as GRF 1-29 Amide, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth...

    Biopro Chemicals Co., Ltd.
    Verified Supplier

    Shanghai

    Best Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 wholesale

    Brand Name:BestSteroid

    Model Number:2mg

    Place of Origin:Hubei,China

    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Best DSIP Delta Sleep Inducing Peptide DSIP 2mg/ vial Human Growth Hormone Peptides wholesale

    Brand Name:Zhenxiang

    Model Number:DSIP

    Place of Origin:CHINA

    ...DSIP Delta Sleep Inducing Peptide DSIP 2mg Human Growth Hormone Peptides DSIP Specification 2mg/vial DSIP CAS No. 62568-57-4 DSIP Full name Delta Sleep ...

    Changsha Zhenxiang Biotechnology Co., Ltd.
    Verified Supplier

    Hunan

    Best Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315 wholesale

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ...Bodybuilding White powder Growth Hormone Peptides 1mg Follistatin 315 Antibody FST-315 Quick Detail: Product name Follistatin 315 Other name ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Best CAS 77591-33-4 Human Growth Hormone Peptides Steroid TB500 Powder For Muscle Gaining wholesale

    Brand Name:Pharmlab

    Model Number:77591-33-4

    Place of Origin:China

    ...Human Growth Hormone Peptides Steroid TB500 Powder For Muscle Gaining CAS 77591-33-4 Besic Information Product name: TB500 ...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Best CAS 75921-69-6 Growth Hormone Peptides Raw Powder MT1 / Melanotan 1 wholesale

    Brand Name:kafen

    Model Number:75921-69-6

    Place of Origin:China

    ...CAS 75921-69-6 Growth Hormone Peptides Raw Powder MT1 / Melanotan 1 Basic View: Alias: Melanotan-1, Melanotan I, Afamelanotide, Melanotan, CUV1647, EPT1647, NDP-...

    Guangzhou Kafen Biotech Co.,Ltd
    Verified Supplier

    Guangdong

    Best High Purity Human Growth Hormone Powder Muscle Growth Peptides CAS 12629-01-5 wholesale

    Brand Name:shinrezing

    Model Number:12629-01-5

    Place of Origin:China

    ...Product Description Product name:Human (Growth) Peptide Hormone 1) Chemicalname:cb311;crecormon;humatrope;ly137998;norditropin;sj0011;OVINE SOMATOTROPIN;SOMATOTROPIN 2) CAS NO.:12629-01-5 3) Formula:...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Best Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial wholesale

    Brand Name:NJBN

    Model Number:87616-84-0

    Place of Origin:MADE IN CHINA

    ...Muscle Building Peptides , GHRP-6 87616-84-0 Growth Hormone Peptides10mg / vial Product Name GHRP-6 Alias GHRP-6 (Growth hormone releasing peptide) CAS 87616-84-0 MF C46H56N12O6 Einecs N/A Molecular Weight 873.01 Purity (HPLC) 98.0%...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Best Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 wholesale

    Brand Name:YIHAN

    Model Number:IGF-1 LR3

    Place of Origin:CHINA

    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Best Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth wholesale

    Brand Name:Gensci

    Model Number:10iu/vial,10vials/kit

    Place of Origin:China manufacturer

    ...Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth == What kind of HGH do you have ? Here is our HGH in the from,pls ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Best Thymosin Beta 4 Peptides 2mg/Vial Tb500 Thymosin Beta-4/Tb4 For Human Growth Hormone wholesale

    Brand Name:Muscle Man

    Model Number:77591-33-4

    Place of Origin:Hunan,China

    ...Thymosin Beta 4 Peptides 2mg/Vial Tb500 Thymosin Beta-4/Tb4 For Human Growth Hormone Product Details: Synonyms: Thymosin Beta-4, Thymosin Beta-4 Acetate, Thymosin β4, TB-500 CAS NO.: 77591-33-4 ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Verified Supplier

    Hunan

    Best Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 wholesale

    Model Number:99%

    Place of Origin:China

    ...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Best Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7 wholesale

    Brand Name:YC

    Model Number:158861-67-7

    Place of Origin:China

    ...Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7​ GHRP-2, like its brother GHRP-6, is a hexapeptide that is a pure growth hormone secretagogue. In addition, GHRP-2 is a synthetic...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Best 191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin wholesale

    Brand Name:Bodybiological

    Model Number:96827-07-5

    Place of Origin:Hubei, China

    ...Hygetropin Human Growth Hormone Peptide HGH 191AA 100iu Hygetropin GH Product details: CAS No. : 96827-07-5 Purity : 97% Place ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Best The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock White lyophilized powder wholesale

    Brand Name:NO

    Model Number:5 mg

    Place of Origin:China Mainland

    ...The best peptide source Hexarelin Acetate 2mg Growth Hormone Steroid USA Stock for Muscle Gain Product Descriptions: CAS Number: 140703-51-1 Molecular Formula: C47H58N12O6 ...

    Walk Bio-Tech Co., Ltd.
    Verified Supplier

    Guangdong

    Best Sermorelin ( GHRH ) 5mg  Increase Human Growth Hormone Peptide Sermorelin acetate wholesale

    Brand Name:ChineseHormone

    Model Number:CAS 86168-78-7

    Place of Origin:China

    ... the secretion of Growth Hormone Releasing Hormone (GHRH) from the hypothalamus, a gland adjacent to the pituitary gland. Sermorelin ( GHRH ) 5mg Increase Human Growth Hormone Peptide Sermorelin acetate Sermorelin Quick View: Sermorelin is a peptide that...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Best GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0 wholesale

    Brand Name:Blue Dragon

    Model Number:GHRP-6 5mg & 10mg

    Place of Origin:China Manufacturer

    ...99% GHRP-6 5mg Growth Hormone Releasing Hexapeptide 10mg 87616-84-0 Fat Loss 1, GHRP-6 Profile: Product Name: GHRP-6 Specification: 5mg & 10mg Synonyms: Growth Hormone Release Peptide-6; Growth Hormone Releasing Hexapeptide CAS: 87616-84-0 MF: C46H56N12O6 ...

    Zhuhaishi Shuangbojie Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Best Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 wholesale

    Brand Name:HZ

    Model Number:86168-78-7

    Place of Origin:China

    ...Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 ...

    Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
    Active Member

    Hubei

    Go to Page
    Inquiry Cart 0