Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Chemical Projects >

Sermorelin Growth Hormone

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    sermorelin growth hormone

    All sermorelin growth hormone wholesalers & sermorelin growth hormone manufacturers come from members. We doesn't provide sermorelin growth hormone products or service, please contact them directly and verify their companies info carefully.

    Total 8063 products from sermorelin growth hormone Manufactures & Suppliers
    Best CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC wholesale

    Brand Name:Ycphar

    Model Number:863288-34-0

    Place of Origin:China

    CJC-1295 Mod GRF 1-29 Growth Hormone Peptides CJC-1295 DAC Fat Loss CJC-1295 no DAC Quick Detail of CJC 1295 Product name CJC-1295 without DAC Synonyms Mod GRF 1-29, CJC-1295 no DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2 CAS Number 863288-34-0 Purity >98% by HPLC Molecular Formula C152H8252N44O42 Apperance white powder General Infomation Of CJC 1295 Description CJC-1295 DAC and CJC-1295 (also known as

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Best Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical wholesale

    Brand Name:Fulu

    Model Number:86168-78-7

    Place of Origin:China

    Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification 2mg/vail Assay 99.5% Appearance White powder Sermorelin Descriptions Sermorelin ( GHRH ) is a bio-identical hormone that has recently been genetically engineered to stimulate the secretion of Hormone Releasing Hormone ( GHRH ) from the hypothalamus, a

    SuZhou FuLu Biotech Co.,Ltd
    Verified Supplier

    Jiangsu

    Best Sermorelin Acetate Growth Hormone Muscle Building Peptides Pharmaceutical Active Ingredients  wholesale

    Brand Name:Shuangbojie

    Model Number:Sermorelin Acetate

    Place of Origin:China

    Polypeptide Growth Hormone Sermorelin Acetate/ Sermorelin with 2mg Bodybuilding 1. Sermorelin Information: Product Name:Sermorelin Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 Molecular weight: 3357.88 Peptide purity: > 98.0% Appearance: White lyophilized powder Related substance: Total Impurities (%) ≤ 2.0% Acetate content: ≤ 15.0% Bacterial Endotoxins: ≤5 IU/mg Sequence: H-Tyr-Ala-

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Best Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 wholesale

    Model Number:99%

    Place of Origin:China

    Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular Formula C149H246N44O42S One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2 Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized (freeze-dried) Stability 2 months at room temperature 24 months from date of receipt, 20 °C as supplied. 1 month

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Best Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical wholesale

    Brand Name:Fulu

    Model Number:86168-78-7

    Place of Origin:China

    ...Sermorelin Growth Hormone Peptides Anti Aging GHRH GRF 1-29 Bioidentical Quick detail Product Name Sermorelin Chemical Name Sermorelin Acetate, GRF 1-29, CAS Number 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.88 specification ...

    SuZhou FuLu Biotech Co.,Ltd
    Verified Supplier

    Jiangsu

    Best Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 wholesale

    Brand Name:Ycphar

    Model Number:86168-78-7

    Place of Origin:China

    ...Sermorelin Growth Hormone Peptides For Bodybuilding Sermorelin GRF 1-29 Quick Detail of Sermorelin Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Best Raw Sermorelin Growth Hormone Peptides Sermorelin Acetate Bodybuilding 86168-78-7 wholesale

    Brand Name:BestSteroid

    Model Number:2mg

    Place of Origin:Hubei,China

    ...High Purity Growth Hormone Peptides Sermorelin For Mass Muscle Growth Sermorelin Basic Info Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Best Freeze - Dried Powder Gdf -8 / Myostatin Human Growth Hormone Peptides GDF - 8 wholesale

    Brand Name:Sendi

    Model Number:GDF-8

    Place of Origin:China

    ...Freeze - Dried Powder Gdf -8 / Myostatin Human Growth Hormone Peptides GDF - 8 MOQ: 10 vials Payment: Bank Transfer, Western Union, MoneyGram, Bitcoin Shipping Method: HKEMS, ...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Best Anabolic Human Growth Hormone Peptide Tesamorelin 2mg/ Vial for Weight loss and Bodybuilding wholesale

    Brand Name:Pharmlab

    Model Number:218949-48-5

    Place of Origin:China

    ...Bodybuilding Hormone Peptide Anabolic Steroids Weight Loss Tesamorelin 2mg/ Vial Quick detail Product name: Tesamorelin Other name: Sermorelin Acetate CAS: 218949-48-5 Appearance: white lyophilized powder purity: 99% Trademark: Pharmlab Original: China...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Best Hexarelin Acetate HEX human growth hormone steroids White Lyophilized Powder wholesale

    Brand Name:steriodshow

    Model Number:Hexarelin 2mg / vial

    Place of Origin:china manufactuer

    ...Hexarelin 2mg Lyophilized Peptide High Purity Hexarelin Acetate HEX Releasing Peptide Growth Hormone Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price served; ...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Best Medicine Grade Oxytocin Growth Hormone Peptides / HGH Peptide Fragment CAS 50-56-6 wholesale

    Brand Name:DW

    Model Number:CAS No:50-56-6

    Place of Origin:China

    ...Medicine Grade Oxytocin Growth Hormone Peptides / HGH Peptide Fragment CAS 50-56-6​ 1 . Specification Product Name: Oxtocin CAS: 50-56-6 ...

    Doublewin Biological Technology Co., Ltd.
    Verified Supplier

    Guangxi

    Best Growth Hormone Peptides Oxytocin 2mg / vial For Hasten Parturition CAS 50-56-6 wholesale

    Brand Name:Yvonne

    Model Number:50-56-6

    Place of Origin:China

    ...Growth Hormone Peptides Oxytocin 2mg / vial For Hasten Parturition CAS 50-56-6 1. Oxytocin Details: Name: oxytocin synonyms: +...

    Wuhan Lianshangwang Technology Co.,LTD
    Verified Supplier

    Hubei

    Best USP Standard Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 wholesale

    Brand Name:Mking

    Model Number:CAS 53-39-4

    Place of Origin:Hubei, China

    ...Muscle Growth Hormone Oral Oxandrolone / Anavar 53-39-4 USP Standard Oxandrolone / Anavar Quick Info Product Name: Oxandrolone CAS: ...

    Hubei Mking Biotech Co., Ltd.
    Verified Supplier

    Hubei

    Best Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 wholesale

    Brand Name:YIHAN

    Model Number:IGF-1 LR3

    Place of Origin:CHINA

    ...Research Igf-1 Lr3 Human Growth Hormone Peptide Bodybuilding Mgf IGF-1 LR3 CAS 946870-92-4 Product information: Product name:GF-1Lr3 CAS ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Best Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth wholesale

    Brand Name:Gensci

    Model Number:10iu/vial,10vials/kit

    Place of Origin:China manufacturer

    ...Injectable Human Growth Hormone HGH Jintropin For Anti Aging / Muscle Growth == What kind of HGH do you have ? Here is our HGH in the from,pls ...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Best Muscle Building Peptides Steroids Powder 2mg/Vial Sermorelin Growth Hormone GRF 1-29 NH2 wholesale

    Model Number:99%

    Place of Origin:China

    ...Muscle Building Steroids Peptides Powder Sermorelin for Lean Muscle Growth Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hongkong

    Best 99% Pure White Powder Growth Hormone Peptides Hexarelin CAS 140703-51-1 wholesale

    Brand Name:NJBN STEROID

    Model Number:140703-51-1

    Place of Origin:MADE IN CHINA

    ... Growth Hormone Peptides Hexarelin CAS 140703-51-1 Brief Inreocution of Growth Hormone Peptides Hexarelin Product name Hexarelin Other Name HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE...

    Nanjing Bangnuo Biotechnology Co., Ltd
    Verified Supplier

    Jiangsu

    Best Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7 wholesale

    Brand Name:YC

    Model Number:158861-67-7

    Place of Origin:China

    ...Factory Direct Supply Human Growth Hormone Peptide Ghrp-2 Cycle For Loss Fat CAS 158861-67-7​ GHRP-2, like its brother GHRP-6, is a hexapeptide that is a pure growth hormone secretagogue. In addition, GHRP-2 is a synthetic...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Best 191AA Human Growth Hormone Peptide HGH 100iu GH 96827-07-5 Hygetropin wholesale

    Brand Name:Bodybiological

    Model Number:96827-07-5

    Place of Origin:Hubei, China

    ...Hygetropin Human Growth Hormone Peptide HGH 191AA 100iu Hygetropin GH Product details: CAS No. : 96827-07-5 Purity : 97% Place ...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Best 99% Purity Fitness Growth Hormone Peptides Muscle Building Steroids Gh Fragment 176-191 wholesale

    Brand Name:Yuancheng

    Model Number:57773-63-4

    Place of Origin:China

    ...Fitness Growth Hormone Peptides Gh Fragment 176-191 H-GH Fragments 176-191 Details H-GH Fragments 176-191 Name: ...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Best GHRP-6 5mg Growth Hormone Releasing Peptide Hexapeptide 10mg 87616-84-0 wholesale

    Brand Name:Blue Dragon

    Model Number:GHRP-6 5mg & 10mg

    Place of Origin:China Manufacturer

    ...99% GHRP-6 5mg Growth Hormone Releasing Hexapeptide 10mg 87616-84-0 Fat Loss 1, GHRP-6 Profile: Product Name: GHRP-6 Specification: 5mg & 10mg Synonyms: Growth Hormone Release Peptide-6; Growth Hormone Releasing Hexapeptide CAS: 87616-84-0 MF: C46H56N12O6 ...

    Zhuhaishi Shuangbojie Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Best Hexarelin Powder Performance Enhancing Human Growth Hormone For Weight Loss CAS 140703-51-1 wholesale

    Brand Name:Biofriend

    Model Number:140703-51-1

    Place of Origin:China

    ...Hexarelin Powder Performance Enhancing Human Growth Hormone Peptide For Fat Loss CAS 140703-51-1 Quick Details: * Product name: Hexarelin/ Examorelin * Synonyms: L-lysinamide, L-...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Best Lyophilized Peptide Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding wholesale

    Brand Name:Biopro

    Model Number:PEP-116

    Place of Origin:China

    ... Sermorelin Growth Hormone Peptides Sermorelin Acetate for Bodybuilding Description Sermorelin Acetate, also known as GRF 1-29 Amide, is a Growth Hormone Releasing Hormone (GHRH) produced by the brain that stimulates the production and release of Growth...

    Biopro Chemicals Co., Ltd.
    Active Member

    Shanghai

    Best Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 wholesale

    Brand Name:HZ

    Model Number:86168-78-7

    Place of Origin:China

    ...Ghrh Rleasing Sermorelin Growth Hormone Peptides Grf 1-29 CAS 86168-78-7 Synonyms: GRF 1-29, Sermorelina, Sermoreline, Sermorelinum CAS NO.: 86168-78-7 Molecular Formula: C149H246N44O42S Molar Mass: 3357.96 PubChem: CID 16129620 ...

    Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
    Active Member

    Hubei

    Go to Page
    Inquiry Cart 0