Sign In | Join Free | My xuijs.com
xuijs.com
Products
Search by Category
Wholesale Marketplace
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    thymosins hormone function

    All thymosins hormone function wholesalers & thymosins hormone function manufacturers come from members. We doesn't provide thymosins hormone function products or service, please contact them directly and verify their companies info carefully.

    Total 459 products from thymosins hormone function Manufactures & Suppliers
    Best Healthy 2mg HGH Growth Hormone TB-500(Thymosin beta-4) CAS77591-33-4 White Powder for Healing Wound wholesale

    Brand Name:Filter

    Model Number:77591-33-4

    Place of Origin:China

    ... supply TB-500(Thymosin beta-4) CAS77591-33-4 with high quality Function TB-500 is a synthetic version of the naturally occurring peptide present in virtually all human and animal cells, Thymosin Beta-4. This potent...

    Passion Technology Development Limited
    Verified Supplier

    Henan

    Best 99% Purity Hgh Human Growth Hormone  Melanotan 2 Powder For Tanning wholesale

    Brand Name:Accenturebio

    Model Number:apigenin

    Place of Origin:China

    ... our body that stimulates melanogenesis, which is responsible for pigmentation of the skin. This peptide hormone, called alpha-Melanocyte stimulating hormone or MSH, activates certain melanocortin receptors in the process of exerting

    Accenture Biotech Co.,Ltd
    Verified Supplier

    Best Growth Raw Material Peptide Protein Hormones Polypeptide Hormone Ghrp -6 CAS 87616-84-0 wholesale

    Brand Name:shinrezing

    Model Number:87616-84-0

    Place of Origin:China

    ...Growth Raw Material Peptide Protein Hormones Polypeptide Hormone Ghrp -6 CAS 87616-84-0 Quick detail Ghrp-6 Product Name;GHRP-6 Ghrp-6 CAS Number;87616-84-0 ...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Best 99% Good Quality Muscular Repair and Recovery Peptide Thymosin Beta 4 (TB-500) CAS 77591-33-4 2mg wholesale

    Brand Name:Keray

    Model Number:77591-33-4

    Place of Origin:China

    ...99% Good Quality Muscular Repair and Recovery Peptide Thymosin Beta 4 (TB-500) CAS 77591-33-4 2mg Tags: injuries; peptides;TB500;Thymosin Beta 4 Introduction Thymosin Beta-4 is a naturally occurring peptide present in almost all...

    Shenzhen Keray Biotech Co., Ltd
    Verified Supplier

    Guangdong

    Best Promoting Healing TB 500 Protein Peptide Growth Hormone Thymosin Beta wholesale

    Brand Name:Bodybiological

    Model Number:TB 500

    Place of Origin:Hubei, China

    ...Promoting Healing TB 500, 5mg/vial, 100% Safe to Brazil Protein Peptide Hormones Basic Info: Tb-500 (Thymosin Beta) 2mg/Vial 5mg/Vial We also sell our peptides in small vials. The...

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Best Fat Loss Peptide GHRP-6 Human Growth Hormone Peptide 5mg 10mg / Vial Weight Loss Lab Supply wholesale

    Brand Name:YIHAN

    Model Number:GHRP-6

    Place of Origin:China

    ... Quick detail: GHRP-6 (5mg/vial;10mg/vial) GHRP-2 (Pralmorelin) Alias: GHRP-2 Acetate; (DES-ALA3)-GROWTH HORMONE-RELEASING PEPTIDE-2 CAS: 158861-67-7 M.F.: C42H50N8O5 M.W.: 746.90 M.S.: Purity (HPLC): 98.0%min. Appearance: White powder...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Best CAS 221231-10-3 Human Growth Hormone Peptide Somatropin Injection 2iu / Vial wholesale

    Brand Name:YIHAN

    Model Number:hgh pen

    Place of Origin:CHINA

    ...High quality bodybuilding Somatropin Cartridges Somatropin injection Human Growth Hormone HGH pen 2iu/vial,10vial/kit Product Description Frag 176-191 Synonyms: Fragment 177-191, ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Guangdong

    Best Fat Lossing Thymosin Beta 4 , White / Yellow Powder TB 500 Peptide CAS 77591-33-4 wholesale

    Brand Name:GZ Body Chemical

    Model Number:CAS 9002-72-6

    Place of Origin:China

    ...CAS 77591-33-4 Thymosin Beta-4 Protein Peptide Hormones TB500 Acetate for Lossing Fat Basic infor: Items Specifications Results Appearance White/yellowish powder White ...

    GZ Body Chemical Co., Limited
    Verified Supplier

    Guangdong

    Best Bodybuilding Peptide Growth Hormone TB 500 2mg Promote Muscle Healing CAS 77591-33-4 wholesale

    Brand Name:Hongxi Pharm

    Model Number:Hormone Peptide

    Place of Origin:HongKong

    ... 4 for Muscle Bodybuilding TB500 Peptide Details: CAS 77591-33-4 TB500 Product Name:TB500,Thymosin beta 4 acetate CAS:77591-33-4 Molecular Formula:C212H350N56O78S Molecular Weight:4963.50 Specification:2mg/vial ...

    Hongxi International Pharmaceutical Co., Ltd.
    Verified Supplier

    Hongkong

    Best Tb-500 / Tb500 / Thymosin Beta 4 / Thymosin Beta-4 / Tb4 2mg/Vial Raw Steroid Powders wholesale

    Brand Name:Haiwen

    Model Number:CAS: 77591-33-4

    Place of Origin:China

    ...Tb-500 / Tb500 / Thymosin Beta 4 / Thymosin Beta-4 / Tb4 2mg/Vial Product Description TB-500 / TB500 / Thymosin Beta 4 / Thymosin BETA-4 / TB4 TB500 Sequence:Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-...

    Shenzhen Haiwen Biotechnology Co.,Ltd
    Verified Supplier

    Guangdong

    Best 2mg / vial USP GMP Grade HGH Human Growth Hormone Thymosin Beta Tb500 Bodybuilding Peptides wholesale

    Brand Name:holybiological

    Model Number:77591-33-4

    Place of Origin:China

    ...2mg / vial USP GMP Grade Thymosin Beta Tb500 Bodybuilding Peptides 1. Qucik detail: Tb500 CAS No.: 77591-33-4 Tb500 Molecular Formula: C212H350N56O78S ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Best 2mg / vial USP GMP Grade Thymosin Beta Tb500 Bodybuilding Peptides wholesale

    Brand Name:holybiological

    Model Number:77591-33-4

    Place of Origin:China

    ...2mg / vial USP GMP Grade Thymosin Beta Tb500 Bodybuilding Peptides 1. Qucik detail: Tb500 CAS No.: 77591-33-4 Tb500 Molecular Formula: C212H350N56O78S ...

    Hubei Holy Biological Co., Ltd.
    Verified Supplier

    Hubei

    Best 99% Purity Human Growth Hormone Peptide White Powder CAS 863288-34-0 Purity 99% wholesale

    Brand Name:Top Pharm

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 with DAC Function:Hormones and Regulation of Endocrine Function of Drug Certification:GMP, Reach, SGS, FDA Grade Standard:Medicine Grade Type:Chemical Reagent State:...

    TOP PHARM CO.,LIMITED
    Verified Supplier

    Best High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation wholesale

    Brand Name:SGH

    Model Number:12629-01-5

    Place of Origin:China

    ...Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSN ...

    Jiangsu Biostronger Technology Co.,Ltd
    Verified Supplier

    Jiangsu

    Best Legit Gonadorelin Gnrh Natural Steroid Peptide Hormones For Human Growth , 99% Assay wholesale

    Brand Name:nanjian

    Model Number:2mg/Vial

    Place of Origin:China

    ... Gnrh 2mg 10mg/Vial Peptides for Human Growth Gonadorelin is another name for gonadotropin-r eleasing hormone Name:Gonadorelin Sequence: Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 Product...

    Hubei Yuancheng Saichuang Technology Co., Ltd.
    Verified Supplier

    Hubei

    Best Safe Hygetropin Growth Hormone , Natural HGH Supplements 8iu/Vial 200iu/Box wholesale

    Brand Name:Pharma Grade

    Model Number:200iu

    Place of Origin:Zhejiang,China

    ...Natural Human Growth Hormone Hygetropin 8iu/vial* 200iu/box for weight loss 200iu/kit Hygetropin: Product name:Hygetropin hgh ...

    HONGKONG RONGXIN BIO-TECH CO.,LTD
    Verified Supplier

    Shaanxi

    Best Legal Human Growth Hormone Peptide GHRP-6/KP102 For Increasing Strength GPA 748 wholesale

    Brand Name:TY-Chemical

    Model Number:87616-84-0

    Place of Origin:China(WhatApp:+8618148706580)

    ... Hormone Short Stature Growth Hormone Deficiency Growth Hormone Level Growth Hormone Concentration Hi Friend, All of peptides injection is here ! We will safely deliver the parcel of LGF-1LR3,Fragment 176-191,TB 500 ,Thymosin...

    Guangzhou Teng yue Chemical Co., Ltd.
    Verified Supplier

    Guangdong

    Best Legal Growth Hormone Releasing Peptide GHRP-6/-2 GHRP-6220vial For Muscle Growth Cas 87616-84-0 wholesale

    Brand Name:Saichuang

    Model Number:87616-84-0

    Place of Origin:China

    ... GHRP-6 Other Name Growth Hormone Releasing Peptide CAS No. 87616-84-0 EINECS N/A MF C46H56N12O6 MW 873.01 Density 1.43 Purity 99% min Usage Peptides; Hormones and Regulation of Endocrine Function of D Appearance White...

    Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
    Verified Supplier

    Hubei

    Best 2 Mg/Vial Thymosin Alpha 1 Muscle Building Peptides CAS 77591-33-4 KOSHER Standard wholesale

    Brand Name:TINGYI

    Model Number:CAS:62304-98-7

    Place of Origin:CHINA

    ... 1 CAS: 62304-98-7 MF: C129H215N33O55 MW: 3108.28 Synonyms: Thymosin α1 Acetate;Thymosin α 1 Acetate(Thymalfasin);Thymosina1Acetate;thymosin α1 bovine;Thymosinα1 bovine,Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-...

    Chongqing Tingyi Biotechnology Co.,Ltd
    Verified Supplier

    Chongqing

    Best 99.5% Purity Raw Powder Anabolic Peptides Hormone Selank 2mg/vial For Bodybuilding wholesale

    Brand Name:Muscle Man

    Model Number:129954-34-3

    Place of Origin:Hunan,China

    ...99.5% Purity Raw Powder Anabolic Peptides Hormone Selank 2mg/vial For Bodybuilding Quick Detail: Product Name:Selank Assay:99% Usage:Increased Sensory ...

    Zhuzhou Interial Biotechnology Co., Ltd
    Site Member

    Hunan

    Go to Page
    Inquiry Cart 0