Sign In | Join Free | My
Search by Category
Wholesale Marketplace
Home > Measurement & Analysis Instruments >

Measuring & Analysing Instrument Design Services

Measuring & Analysing Instrument Design Services

All Measuring & Analysing Instrument Design Services wholesalers & Measuring & Analysing Instrument Design Services manufacturers come from members. We doesn't provide Measuring & Analysing Instrument Design Services products or service, please contact them directly and verify their companies info carefully.

Total 3396 products from Measuring & Analysing Instrument Design Services Manufactures & Suppliers
Best FANN Instruments Viscometer Model 35A 207198 wholesale

Brand Name:FANN

Model Number:207198

Place of Origin:USA

Fann Instrument Company specializes in the design and manufacture of instrumentation for measuring the physical and chemical properties of various fluid properties and especially the measurement of flow and viscosity. Their product line is the most ...

Shenzhen PMZ Technology Inc.
Active Member

Best Peptide synthesis  API powder ACTH(1-39) / Corticotropin CAS 9002-60-2 pharmaceutical intermediate wholesale

Brand Name:Youngshe Peptide

Model Number:CAS No: 9002-60-2

Place of Origin:China

ACTH(1-39) / Corticotropin 1.Basic information: Cas No: 9002-60-2 Formula: C207H308N56O58S Molecular: 4541.0658 Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF Purity: 98% Appearance: white powder Source: synthetic Also known as: Adrenocorticotropin, ...

Chengdu youngshe chemical Co,.Ltd
Active Member

Best Power Voltage Converter AC 110V-220V to DC 0-48V Module Switching Power Supply Digital Display 100W Voltage Regulator wholesale

Brand Name:PR

Model Number:PR-A100

Place of Origin:China

Switching Power Supply _ PR-100 Series Two years warranty Built-in EMI filter 100% Load aging test Wide range of input voltage Accurate and stable output voltage Output over-voltage, over-current and short-circuit protection Low output ripple and noise ...

Power Real CO.,Limited
Site Member


Best 5mm silver mirror  Waterproof Silver Mirror Glass, Double Coated with Italy Fenzi Paints wholesale

Brand Name:OBG

Model Number:customized

Place of Origin:Qingao

Silver mirror Specifications: Thickness 2 mm to 6 mm Size according to your design. Payment terms T/T 30% as deposited and balance should be send to us for as copy of Bill of loading. Min. Order: 100Pieces per Item Use: For bath mirror, decorative mirror ...

Qingdao Oriental Brother New Energy Technology Co., Ltd.
Active Member


Best 18K Luxury Gold Jewelry Love Necklace 18K Gold Love Ring Pendant with 2 Diamonds B7219500 wholesale

Place of Origin:China

Brand Name:18K Gold Luxury Jewelry

Model Number:B7219500

18K Luxury Gold Jewelry Love Necklace 18K Gold Love Ring Pendant with 2 Diamonds B7219500 SETTING Metal Type: 18K gold MAIN STONE Stone Type: Natural Diamonds Weight: Approx. 0.03ct Quantity: 2pcs Cut: round Color: F-G white Clarity: VVS/slightly defects ...

Shenzhen Jsely Jewelry Co., Ltd.
Site Member


Best CONTEC MS100 SpO2 Simulator Patient Oximeter Simulator with DC Power wholesale

Place of Origin:China

Model Number:MS100

Brand Name:Contec

CONTEC MS100 SpO2 Simulator Patient Oximeter Simulator Brief Introduction MS100 SpO2 Simulator is a kind of Separated SpO2 simulator, small and light. It can perform a series of tests for the oximeter by simulation means, and gives cognizance of veracity ...

Shenzhen Huge Creation Technology Limited
Verified Supplier


Best Long cycle life rechargeable lithium ion battery to storage solar energy 3.2V35Ah wholesale

Brand Name:HJY

Model Number:HJY-LFP26136181-35


Max Discharging Rate Max Continuous Discharging:2C Max Peak Discharging:3C Cut-off Voltage Charging:3.65V Discharging:2.0V Internal Resistance ≤ 4mΩ (At 0.2C rate, 2.0V cut-off) Working Temperature Charging: 0℃~45℃ Discharging: -20℃~60℃ Storage...

Shenzhen HJY Technology Co. Ltd.
Site Member

Best 134.2kHz Animal Ear Tag for Pig/Cow/Sheep wholesale

Place of Origin:GuangZhou

Brand Name:L-Link

Model Number:L-Link_AM01

the electronic ear tag is mainly used in livestock tracking and management, such as cows, dogs, pigs and other livestock. Normally it was installed onto the animals’ ear by a special animal ear tag pliers. The electronic ear tag uses non-toxic, no smell...

GuangZhou L-Link Technologies,Inc
Site Member


Best Vertical Truss Tower for Moving Head wholesale

Brand Name:7Clighting

Model Number:7C-LS007

Place of Origin:CHINA

Product Description Product name : Vertical Truss Tower for Moving Head Product No. : 7C-LS007 Item: 7C-LS007 Height Optional: 1M / 1.5M / 2M Tube: Main tubes Φ50×2mm,Single connection bar Size (Top Plate): 350 x 350 x 8mm Size (Base Plate): 600 x 600 x...

Qicai Lighting Equipment Limited
Site Member


Best AC 220 V 1 ph 3 Lines Cellphone Button Life Testing Machine For Industry wholesale

Brand Name:ASLi

Model Number:AS - 8330 C

Place of Origin:China

AS-8300C Button Life testing Machine.pdf Ce Certification Cellphone Button Life Testing Machine For Industry Used Application: Button life testing machine can do the keyboard life test of computer, cell phone, calculator and notepad. Features: 1 Can test ...

Verified Supplier

Best Metal Mesh Curtain Fabrics Window Screen wholesale

Brand Name:YT

Model Number:YT1650

Place of Origin:Anping,Hebei,China

Quick Information Place of Origin:China Description This kind of metallic cloth is contact by many sequins(with 4 branches)and rings, it looks like a spider, each 'leg'of the sequin works in a ring and folded back itself to secure they connect each other....

Anping Yuntong Metal Wire Mesh Co., Ltd
Active Member

Best Hardware accessories counting and packing machine, Hardware accessories pouch making machine wholesale

Brand Name:Bestar Packaging Machine

Model Number:Hardware accessories counting and packing machine

Place of Origin:Foshan ,China

New design Bestar Automatic Hardware accessories counting and packing machine, Hardware accessories pouch making machine,hardware accessories weighting and packing machine, hardware accessories packing machine, Hardware accessories packaging machine , ...

Bestar Packing Machine Co.Ltd
Site Member


Best PC Carton Compression Tester, Package ,Corrugate Box ,Carton Compression Tester wholesale

Place of Origin:Guangdong, China (Mainland)

Brand Name:HAIDA

Model Number:HD-A502S-1500

PC Carton Compression Tester, Package ,Corrugate Box ,Carton Compression Tester Specifications Concrete Compressive Strength Tester Price 1.Motor:Import servo motor 2.Control system:Computer control Product introduce: PC Carton Compression Tester main for...

Dongguan Haida Equipment Co.,LTD
Verified Supplier


Best big bag /open top jumbo bag 1500kg loading OEM Made in China wholesale

Brand Name:Hongye

Model Number:HY-FIBC-125

Place of Origin:China

Product Name PP woven bag/ Grain bag/ Fertilizer bag/ Chemical powder bag/ Sand sack Load capacity 500kg-2000kg Denier 350 to 1200 Regular size 85*85*90 cm 90*90*100cm 95*95*110cm as customer request GSM 40 GSM TO 250 GSM Top Top full open/Filling spout/ ...

Qinhuangdao Hongye Packing Products Co., Ltd.
Active Member


Best Intelligent Septic System Pump Control Panel wholesale

Brand Name:Leading

Model Number:L922-S

Place of Origin:CHINA

Intelligent Sewage Three Phase Water Pump Controller- Auto / Manual , One Button Calibration ,With LCD Displaying Product Brief: L922-S Sewage Pump controller ,is a smart and intelligent three phase fully automatic pump controller with built-in water ...

Hunan Leading Science and Technology Development Co.,Ltd
Verified Supplier


Best Button Force Testing Equipment 3 Points / 4 Points Bending Test Machine wholesale

Brand Name:Infinity Machine

Model Number:RS-6900H

Place of Origin:China

Button Force Testing Equipment 3 Points / 4 Points Bending Test Machine Model: RS-6900H Application: This servo control Multi-function tester is controlled by X,Y,Z axes, it is suitable for the button force test, the compression for electronic products, ...

Infinity Machine International Inc.
Verified Supplier


Best Spot welding tip for enamelle wire welding wholesale

Brand Name:shouchuang

Place of Origin:China

Place of Origin: Guangdong, China (Mainland) Brand Name: shouchuang Model Number: customization Material: tungsten-molybdenum alloy Application: welding for electronic components life: 30-100k times Model: customization Payment: T/T Package: Carton ...

HeFei Zulr Trade Co.,Ltd
Active Member

Best shower door knob shower door hardware WL-3004 Dia.30x32mm glass door handle wholesale

Brand Name:WL

Model Number:WL-3004

Place of Origin:Foshan China

shower door knob shower door hardware WL-3004 Dia.30x32mm glass door handle material: 304# stainless steel or copper/brass finished: chrome / satin size: Dia.30x32mm function: shower door handle packing: by carton No.: 30pcs/box MOQ: 100/pcs 10000pcs/week...

Willing Hardware Manufacturing Company
Active Member

Best Diagonal Eyepiece worked for TOPCON wholesale

Brand Name:NO BRAND

Model Number:DFE-1TPA

Place of Origin:CHINA

Diagonal Eyepiece worked for TOPCON Specification Type Description DFE-1TPA For TOPCON instruments with external threads

Verified Supplier


Best Good quality with competive price smart Pdlc film from China wholesale

Brand Name:CONE

Model Number:C-SFF

Place of Origin:CHINA

Smart film is an intelligent film which can adjust light under electric pressure to switch between transparent and opaque. When power off, the film turns opaque and when power on the film turns transparent. Perfectly meet the double requirements of glass ...

Cone Industrial Co., Limited
Site Member


Go to Page
Inquiry Cart 0